PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400006615
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 200aa    MW: 22781.8 Da    PI: 9.3426
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400006615genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.96.4e-29959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          k+ien++nrqvt+skRrng++KKA+EL vLCda+v+++++sstgkl+e++s
  PGSC0003DMP400006615  9 KKIENQTNRQVTYSKRRNGLFKKANELTVLCDAKVSIVMISSTGKLHEFIS 59
                          68***********************************************86 PP

2K-box66.59.3e-2371140170
                 K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKn 70 
                           yqk+ g++ +++++e++q++l+kLk+ ++nL++e+R+++Ge+L++L++++L++L +++++slk iR++K+
  PGSC0003DMP400006615  71 YQKTIGVDIWTSHYEKMQEQLRKLKDVNRNLRKEIRQRMGESLNDLNFEQLEELMENVDNSLKLIRERKD 140
                           78888999*************************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.6E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.609161IPR002100Transcription factor, MADS-box
CDDcd002656.21E-39280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-27323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-35395IPR002100Transcription factor, MADS-box
PfamPF003195.5E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-273859IPR002100Transcription factor, MADS-box
PfamPF014864.2E-1482141IPR002487Transcription factor, K-box
PROSITE profilePS5129710.96584191IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010093Biological Processspecification of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MARGKIQIKK IENQTNRQVT YSKRRNGLFK KANELTVLCD AKVSIVMISS TGKLHEFISP  60
SITTKQLFDL YQKTIGVDIW TSHYEKMQEQ LRKLKDVNRN LRKEIRQRMG ESLNDLNFEQ  120
LEELMENVDN SLKLIRERKD ARQEDPYGGL VEQEGDYNSV LGFPTGGHHI LALGLQPNNN  180
HHHHLHSGGG SDITTFALG*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00077ChIP-seqTransfer from AT3G54340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX675080.0X67508.1 S.tuberosum def4 mRNA for deficiens analogue (clone pd4).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001234077.21e-132APETALA3 homolog LeAP3
RefseqXP_015072271.11e-132PREDICTED: floral homeotic protein PMADS 1
SwissprotQ074721e-114MADS1_PETHY; Floral homeotic protein PMADS 1
TrEMBLM0ZWE01e-147M0ZWE0_SOLTU; Uncharacterized protein
STRINGSolyc04g081000.2.11e-131(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54340.13e-72MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]